PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10032764
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 269aa    MW: 29158.2 Da    PI: 8.3789
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10032764genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.91.1e-183883147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd  l ++v+++G+++W++I+r+++ gR++k+c++rw + 
      Lus10032764 38 KGPWSAEEDRVLTRLVERHGPRNWSLISRYIN-GRSGKSCRLRWCNQ 83
                     79******************************.***********985 PP

2Myb_DNA-binding521.6e-1692134347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++ Ed  ++ a++++G++ W+tIar ++ gRt++ +k++w++ 
      Lus10032764  92 PFSASEDHTILAAHARYGNR-WATIARLLP-GRTDNAVKNHWNST 134
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.7843388IPR017930Myb domain
SuperFamilySSF466895.75E-3135131IPR009057Homeodomain-like
SMARTSM007171.7E-143786IPR001005SANT/Myb domain
PfamPF002491.1E-173883IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-233991IPR009057Homeodomain-like
CDDcd001672.77E-154082No hitNo description
SMARTSM007172.5E-1389137IPR001005SANT/Myb domain
PROSITE profilePS5129419.91589139IPR017930Myb domain
PfamPF002497.5E-1492134IPR001005SANT/Myb domain
CDDcd001671.55E-1092135No hitNo description
Gene3DG3DSA:1.10.10.604.6E-2192138IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MDPMLHNNNM CSTSSTTSDS SSSDSAATGS AKRTDRIKGP WSAEEDRVLT RLVERHGPRN  60
WSLISRYING RSGKSCRLRW CNQLCPTVQH RPFSASEDHT ILAAHARYGN RWATIARLLP  120
GRTDNAVKNH WNSTLKRRAF SGHGQTSSSS PPQAAVFHQR AASDGNYSTQ EYCWNYGEGC  180
LSPATPAAVV EVDTEETLTT LTLAPPGMGS GGGGQGMSNV AEEKRADSMP AGFWDVMRGV  240
IAKEVREYVN STMSSESPTP TAAASYFH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-40371393105MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-393713957159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-393713957159MYB PROTO-ONCOGENE PROTEIN
1mse_C7e-40371393105C-Myb DNA-Binding Domain
1msf_C7e-40371393105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012071707.11e-90PREDICTED: myb-related protein A-like
TrEMBLA0A067KQI31e-90A0A067KQI3_JATCU; MYB family protein
STRINGPOPTR_0002s13030.15e-87(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50743256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.12e-56myb domain protein 70